home genetic news bioinformatics biotechnology literature journals ethics positions events sitemap


UBBFriend: Email This Page to Someone!
  HUM-MOLGEN
  Biotechnical requests and sources
  AnaSpec Introduces New Cys-Containing b-Amyloid Peptides

Post New Topic  Post A Reply
profile | register | preferences | faq | search

next newest topic | next oldest topic
Author Topic:   AnaSpec Introduces New Cys-Containing b-Amyloid Peptides
anaspec
Member
posted 10-20-2009 12:03 AM     Click Here to See the Profile for anaspec   Click Here to Email anaspec     Edit/Delete Message Reply w/Quote
Fremont, CA – October 19, 2009

The hallmark of Alzheimer’s disease (AD) pathology includes b-sheet aggregates of b-amyloid peptides in senile plaques and hyperphosphorylated tau protein in neurofibrillary tangles (NFT).1-2 Recent publications have reported the use of Cys-containing mutants as models for aggregation studies.3-5 Shivaprasad and Wetzel employ “the use of disulfide bond cross-linking to probe the fold within the core and the packing interactions between beta-sheets.” Among the Cys mutants they studied is the S26C (Ser substituted with Cys at position 26).3 Upon oxidation of the S26C monomer, cysteines are capable of forming intermolecular disulfide bond creating the S26C dimer.3-4 Using this synthetic dimer, Hu, et al. show that it behaves similarly to b-amyloid dimer-containing human CSF, suggesting that Ab dimers may be the earliest synaptic disrupting species in AD.4

The supplier of the world’s largest collection of b-amyloid GO™ (catalog) Peptides, AnaSpec has added the following amyloid peptides to its selection: b-amyloid (1-40) S26C; b-amyloid (1-42) S26C dimer; b-amyloid (1-42) S26C and other Cys-containing b-amyloid peptides (Cys on the N or C-terminus as well as in the internal sequence).

Besides using these Cys-containing b-amyloid peptides for dimerization, the availability of the Cysteine’s thiol group also allows researchers the flexibility of reacting these peptides with any maleimide containing fluorescent dyes or biomolecules. For example, the thiol group of Cys-b-amyloid (1-40) can react with HiLyte Fluor™ 488, C2 maleimide to form HiLyte Fluor™ 488-Cys-b-amyloid (1-40) [Cys(HiLyte Fluor™ 488)-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV].

References:
1. Khachaturian, ZS. Arch. Neurol. 42, 1097 (1985).
2. Mirra, SS. et al. Neurol. 41, 479 (1991).
3. Shivaprasad, S. and R. Wetzel. J. Biol. Chem. 281, 993 (2006).
4. Hu, N-W. et al. Brain doi:10.1093/brain/awn174.
5. Shankar, GM. et al. Nat. Med. 14, 837 (2008).

About AnaSpec

AnaSpec is a leading provider of integrated proteomics solutions to the world’s largest biotech, pharmaceutical, and academic research institutions. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and antibodies.

For more information visit www.anaspec.com

###

IP: 12.169.96.11

All times are ET (US)

next newest topic | next oldest topic

Administrative Options: Close Topic | Archive/Move | Delete Topic
Post New Topic  Post A Reply
Hop to:

Contact Us | HUM-MOLGEN

Copyright by HUM-MOLGEN 1995-2017

Powered by: Ultimate Bulletin Board, Version 5.44a
© Infopop Corporation (formerly Madrona Park, Inc.), 1998 - 2000.